Two electrical potential–dependent steps are required for transport by the Escherichia coli Tat machinery

The twin-arginine translocation (Tat) pathway in Escherichia coli transports fully folded and assembled proteins across the energy-transducing periplasmic membrane. In chloroplasts, Tat transport requires energy input only from the proton motive force. To elucidate the mechanism and energetics of bacterial Tat protein transport, we developed an efficient in vitro transport assay using TatABC-enriched inverted membrane vesicles and the physiological precursor pre-SufI. We report transport efficiencies of 60–80% for nanomolar pre-SufI concentrations. Dissipation of the pH gradient does not reduce pre-SufI transport efficiency. Instead, pre-SufI transport requires at least two electrical potential (Δψ)–dependent steps that differ in both the duration and minimum magnitude of the required Δψ. The data are consistent with a model in which a substantial Δψ of short duration is required for an early transport step, and in which a small Δψ of long duration is necessary to drive a later transport step.

• Publication year

  2007

• Venue

  Journal of Cell Biology

• Publication date

  2007-10-08

• Fields of study

  Biology, Medicine, Environmental Science

• Identifiers
  DOI 10.1083/jcb.200702082PMID 17908913PMCID 2064739
• External record

  Open on Semantic Scholar

• Source metadata

  Semantic Scholar, PubMed

• No claims are published for this paper.

• No concepts are published for this paper.

• The TatA subunit of Escherichia coli twin-arginine translocase has an N-in topology.

  2007cited by this paper
• The entire N-terminal half of TatC is involved in twin-arginine precursor binding.

  2007cited by this paper
• The chloroplast Tat pathway utilizes the transmembrane electric potential as an energy source.

  2007cited by this paper
• Membrane binding of twin arginine preproteins as an early step in translocation.

  2006cited by this paper
• The bacterial twin-arginine translocation pathway.

  2006cited by this paper
• Efficient Twin Arginine Translocation (Tat) Pathway Transport of a Precursor Protein Covalently Anchored to Its Initial cpTatC Binding Site*

  2006cited by this paper
• Subunit composition and in vivo substrate‐binding characteristics of Escherichia coli Tat protein complexes expressed at native levels

  2006cited by this paper
• Export of complex cofactor-containing proteins by the bacterial Tat pathway.

  2005cited by this paper
• How far will you go to sense voltage?

  2005cited by this paper
• The TatA component of the twin-arginine protein transport system forms channel complexes of variable diameter.

  2005cited by this paper
• The Thylakoid ΔpH/ΔΨ Are Not Required for the Initial Stages of Tat-dependent Protein Transport in Tobacco Protoplasts*

  2005cited by this paper
• Protein targeting by the bacterial twin-arginine translocation (Tat) pathway.

  2005cited by this paper
• The energetics of the chloroplast Tat protein transport pathway revisited.

  2005cited by this paper
• The Escherichia coli twin-arginine translocation apparatus incorporates a distinct form of TatABC complex, spectrum of modular TatA complexes and minor TatAB complex.

  2005cited by this paper
• Common principles in the biosynthesis of diverse enzymes.

  2005cited by this paper
• The thylakoid delta pH/delta psi are not required for the initial stages of Tat-dependent protein transport in tobacco protoplasts.

  2005cited by this paper
• Acid denaturation and refolding of green fluorescent protein.

  2004influential reference
• Phage Shock Protein PspA of Escherichia coli Relieves Saturation of Protein Export via the Tat Pathway

  2004cited by this paper
• A periplasmic fluorescent reporter protein and its application in high-throughput membrane protein topology analysis.

  2004cited by this paper
• Dual Topology of the Escherichia coli TatA Protein*

  2004cited by this paper
• Topological studies on the twin-arginine translocase component TatC.

  2004cited by this paper
• Consensus structural features of purified bacterial TatABC complexes.

  2003cited by this paper
• Differential interactions between a twin-arginine signal peptide and its translocase in Escherichia coli.

  2003cited by this paper
• Thylakoid targeting of Tat passenger proteins shows no ΔpH dependence in vivo

  2003cited by this paper
• Thylakoid targeting of Tat passenger proteins shows no delta pH dependence in vivo.

  2003cited by this paper
• Energetics of protein transport across biological membranes. a study of the thylakoid DeltapH-dependent/cpTat pathway.

  2003cited by this paper
• The bacterial translocase: a dynamic protein channel complex

  2003cited by this paper
• Characterization and membrane assembly of the TatA component of the Escherichia coli twin-arginine protein transport system.

  2002cited by this paper
• Separate Analysis of Twin-arginine Translocation (Tat)-specific Membrane Binding and Translocation in Escherichia coli *

  2002cited by this paper
• Translocation of Jellyfish Green Fluorescent Protein via the Tat System of Escherichia coli and Change of Its Periplasmic Localization in Response to Osmotic Up-shock*

  2001cited by this paper
• Export of active green fluorescent protein to the periplasm by the twin‐arginine translocase (Tat) pathway in Escherichia coli

  2001cited by this paper
• Functional reconstitution of bacterial Tat translocation in vitro

  2001influential reference
• Contribution of electric field (Delta psi) to steady-state transthylakoid proton motive force (pmf) in vitro and in vivo. control of pmf parsing into Delta psi and Delta pH by ionic strength.

  2001cited by this paper
• Purified components of the Escherichia coli Tat protein transport system form a double-layered ring structure.

  2001cited by this paper
• Contribution of electric field (Δψ) to steady-state transthylakoid proton motive force (pmf) in vitro and in vivo. Control of pmf parsing into Δψ and ΔpH by ionic strength

  2001cited by this paper
• Molecular Cloning: A Laboratory Manual

  2001cited by this paper
• TatB and TatC Form a Functional and Structural Unit of the Twin-arginine Translocase from Escherichia coli *

  2001influential reference
• Characterization of the early steps of OE17 precursor transport by the thylakoid DeltapH/Tat machinery.

  2000cited by this paper
• TatD Is a Cytoplasmic Protein with DNase Activity

  2000cited by this paper
• The ratio between the fast and slow forms of bovine cytochrome c oxidase is changed by cholate or nucleotides bound to the cholate-binding site close to the cytochrome a3/CuB binuclear centre

  2000cited by this paper
• Subunit interactions in the twin‐arginine translocase complex of Escherichia coli

  2000influential reference
• The Tat protein export pathway

  2000cited by this paper
• The Twin Arginine Consensus Motif of Tat Signal Peptides Is Involved in Sec-independent Protein Targeting in Escherichia coli *

  2000cited by this paper
• Using Antibodies: A Laboratory Manual

  1999cited by this paper
• Sec-independent Protein Translocation in Escherichia coli

  1999influential reference
• Genome‐wide analysis of integral membrane proteins from eubacterial, archaean, and eukaryotic organisms

  1998cited by this paper
• Overlapping functions of components of a bacterial Sec‐independent protein export pathway

  1998influential reference
• A novel and ubiquitous system for membrane targeting and secretion of cofactor-containing proteins.

  1998cited by this paper
• Measurement of the membrane potential generated by complex I in submitochondrial particles.

  1997cited by this paper
• Sec-independent protein translocation by the maize Hcf106 protein.

  1997cited by this paper
• Common Principles of Protein Translocation Across Membranes

  1996cited by this paper
• A common export pathway for proteins binding complex redox cofactors?

  1996cited by this paper
• Membrane vesicles containing overproduced SecY and SecE exhibit high translocation ATPase activity and countermovement of protons in a SecA- and presecretory protein-dependent manner.

  1993influential reference
• Protein-specific energy requirements for protein transport across or into thylakoid membranes. Two lumenal proteins are transported in the absence of ATP.

  1992cited by this paper
• A proton gradient is required for the transport of two lumenal oxygen-evolving proteins across the thylakoid membrane.

  1991cited by this paper
• Use of T7 RNA polymerase to direct expression of cloned genes.

  1990cited by this paper
• Improved M13 phage cloning vectors and host strains: nucleotide sequences of the M13mp18 and pUC19 vectors.

  1985cited by this paper
• Lactose genes fused to exogenous promoters in one step using a Mu-lac bacteriophage: in vivo probe for transcriptional control sequences.

  1979cited by this paper

• Bacterial protein secretion systems: Mechanisms, functions, and roles in virulence.

  2025cites this paper
• Structure of E. coli Twin-arginine translocase (Tat) complex with bound cargo

  2025cites this paper
• Cell-penetrating peptides stimulate protein transport on the Twin-arginine translocation pathway

  2024cites this paper
• Preparation of Uniformly Oriented Inverted Inner (Cytoplasmic) Membrane Vesicles from Gram-Negative Bacterial Cells.

  2024cites this paper
• A larger TatBC complex associates with TatA clusters for transport of folded proteins across the bacterial cytoplasmic membrane

  2024cites this paper
• The polar amino acid in the TatA transmembrane helix is not strictly necessary for protein function.

  2023cites this paper
• A real-time analysis of protein transport via the twin arginine translocation pathway in response to different components of the protonmotive force

  2023influential citation
• A Real-Time Analysis of Protein Transport via the Twin Arginine Translocation Pathway in Response to Different Components of the Protonmotive Force in vivo

  2023influential citation
• In Vitro Flagellar Type III Protein Transport Assay Using Inverted Membrane Vesicles.

  2023cites this paper
• Occurrence and potential mechanism of holin-mediated non-lytic protein translocation in bacteria

  2022cites this paper
• New insights into the Tat protein transport cycle from characterizing the assembled Tat translocon

  2022cites this paper
• Hydrophobic mismatch is a key factor in protein transport across lipid bilayer membranes via the Tat pathway

  2022cites this paper
• Influence of the TorD signal peptide chaperone on Tat-dependent protein translocation

  2021cites this paper
• Functional analysis of the polar amino acid in the TatA transmembrane helix

  2021cites this paper
• Oligomerization state of the functional bacterial twin-arginine translocation (Tat) receptor complex

  2021cites this paper
• TatA and TatB generate a hydrophobic mismatch important for the function and assembly of the Tat translocon in Escherichia coli

  2021cites this paper
• Hydrophobic mismatch is a key factor in protein transport on the Tat pathway

  2021cites this paper
• Insights into substrate-mediated assembly of the chloroplast TAT receptor complex

  2020cites this paper
• Aktivierung des Psp-Systems durch TatA-induzierten Membranstress in Escherichia coli

  2019cites this paper
• Protein Export into and across the Atypical Diderm Cell Envelope of Mycobacteria

  2019cites this paper
• Transport of Folded Proteins by the Tat System

  2019cites this paper
• Surface-exposed domains of TatB involved in the structural and functional assembly of the Tat translocase in Escherichia coli

  2019influential citation
• The Twin-Arginine Pathway for Protein Secretion

  2019cites this paper
• In Vitro Reconstitution of Functional Type III Protein Export and Insights into Flagellar Assembly

  2018cites this paper
• Tat-exported peptidoglycan amidase-dependent cell division contributes to Salmonella Typhimurium fitness in the inflamed gut

  2018cites this paper
• Routing of thylakoid lumen proteins by the chloroplast twin arginine transport pathway

  2018cites this paper
• The Tat protein transport system: intriguing questions and conundrums.

  2018influential citation
• How to achieve Tat transport with alien TatA

  2017cites this paper
• Tat transport in Escherichia coli requires zwitterionic phosphatidylethanolamine but no specific negatively charged phospholipid

  2017cites this paper
• Assembly pathway of a bacterial complex iron sulfur molybdoenzyme

  2017cites this paper
• Regulation of the ESX-5 Secretion System in Mycobacterium tuberculosis

  2017cites this paper
• A Hinged Signal Peptide Hairpin Enables Tat-Dependent Protein Translocation.

  2017cites this paper
• Twin-arginine translocation in Yersinia : the substrates and their role in virulence

  2016cites this paper
• High Throughput Screen for Escherichia coli Twin Arginine Translocation (Tat) Inhibitors

  2016cites this paper
• The Bacterial Cell

  2016cites this paper
• Mapping protein-protein interactions in the Escherichia coli twin arginine translocase

  2016cites this paper
• Mechanistic Aspects of Folded Protein Transport by the Twin Arginine Translocase (Tat)*

  2015cites this paper
• C-terminal truncation of a Tat passenger protein affects its membrane translocation by interfering with receptor binding

  2015cites this paper
• The twin-arginine protein translocation pathway.

  2015cites this paper
• Reconstruction and modeling protein translocation and compartmentalization in Escherichia coli at the genome-scale

  2014cites this paper
• Tat transport of a Sec passenger leads to both completely translocated as well as membrane-arrested passenger proteins.

  2014cites this paper
• 'Come into the fold': A comparative analysis of bacterial redox enzyme maturation protein members of the NarJ subfamily.

  2014cites this paper
• Twin arginine translocase (Tat) : structural and functional insight

  2014cites this paper
• Protein Routing Processes in the Thylakoid

  2014cites this paper
• The Canonical Twin-Arginine Translocase Components Are Not Required for Secretion of Folded Green Fluorescent Protein from the Ancestral Strain of Bacillus subtilis

  2014cites this paper
• Protein translocation across the inner membrane of Gram-negative bacteria: the Sec and Tat dependent protein transport pathways.

  2013cites this paper
• The glove-like structure of the conserved membrane protein TatC provides insight into signal sequence recognition in twin-arginine translocation.

  2013cites this paper
• Intra-plastid protein trafficking: how plant cells adapted prokaryotic mechanisms to the eukaryotic condition.

  2013cites this paper
• Fluorescence imaging of GFP-fused periplasmic components of Na+-driven flagellar motor using Tat pathway in Vibrio alginolyticus.

  2013cites this paper
• Enough is enough: TatA demand during Tat-dependent protein transport.

  2013cites this paper
• Membrane Protein Family New Functions for the Ancient DedA

  2013cites this paper
• Investigating the function of Ysy6p and the EMC complex

  2013cites this paper
• Effect of cargo size and shape on the transport efficiency of the bacterial Tat translocase

  2013influential citation
• Live cell imaging shows reversible assembly of the TatA component of the twin-arginine protein transport system

  2013cites this paper
• Deciphering the Mechanism of E. coli tat Protein Transport: Kinetic Substeps and Cargo Properties

  2012influential citation
• The ins and outs of Mycobacterium tuberculosis protein export.

  2012cites this paper
• Mapping Precursor-binding Site on TatC Subunit of Twin Arginine-specific Protein Translocase by Site-specific Photo Cross-linking*

  2012cites this paper
• Investigating the physiological roles of YqjA and YghB: members of the conserved DedA membrane protein family in Escherichia coli

  2012influential citation
• New Functions for the Ancient DedA Membrane Protein Family

  2012cites this paper
• Twin-arginine-dependent translocation of folded proteins

  2012cites this paper
• Protein traffic in Gram-negative bacteria--how exported and secreted proteins find their way.

  2012cites this paper
• Conserved Signal Peptide Recognition Systems across the Prokaryotic Domains

  2012cites this paper
• Multiple Envelope Stress Response Pathways Are Activated in an Escherichia coli Strain with Mutations in Two Members of the DedA Membrane Protein Family

  2012cites this paper
• MSLSRRQFIQASGIALCAGAVPLKASA AGQ MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATA AQA SufI TorA consensus motif cleavage site MQRRDFLKYSVALGVASALPLWSRAVFA AER CueO SRRxFLK

  2012cites this paper
• Structural and computational analysis of the Escherichia coli chaperone protein DmsD

  2012cites this paper
• Kinetics of Precursor Interactions with the Bacterial Tat Translocase Detected by Real-time FRET*

  2012influential citation
• The twin-arginine translocation (Tat) protein export pathway

  2012cites this paper
• Characterization of PratA and Tic22 proteins for functions in membrane biogenesis in Synechocystis sp. PCC 6803

  2012cites this paper
• Early Contacts between Substrate Proteins and TatA Translocase Component in Twin-arginine Translocation*

  2011cites this paper
• Investigation of Escherichia coli Tat (twin arginine translocase) transport in vitro

  2011influential citation
• The Tat-dependent protein translocation pathway

  2011cites this paper
• A putative twin-arginine translocation system in the phytopathogenic bacterium Xylella fastidiosa.

  2011cites this paper
• Protein Secretion Systems in Pseudomonas aeruginosa: An Essay on Diversity, Evolution, and Function

  2011cites this paper
• One signal is enough: Stepwise transport of two distinct passenger proteins by the Tat pathway across the thylakoid membrane.

  2010cites this paper
• Chapter 4 Functional reconstitution of the E . coli Tat system by subunits obtained from a thermophilic bacterium

  2010cites this paper
• Twin arginine translocation (Tat)-dependent protein transport: the passenger protein participates in the initial membrane binding step

  2010cites this paper
• The Tat Protein Export Pathway

  2010cites this paper
• TatB Functions as an Oligomeric Binding Site for Folded Tat Precursor Proteins

  2010cites this paper
• The Twin Arginine Transport System Appears To Be Essential for Viability in Sinorhizobium meliloti

  2010cites this paper
• Biogenesis of membrane bound respiratory complexes in Escherichia coli.

  2010cites this paper
• Measurement of the energetics of protein transport across the chloroplast thylakoid membrane.

  2010cites this paper
• Mechanistic Challenges and Engineering Applications of Protein Export in E. coli

  2009cites this paper
• The Escherichia coli Cell Division Protein and Model Tat Substrate SufI (FtsP) Localizes to the Septal Ring and Has a Multicopper Oxidase-Like Structure

  2009cites this paper
• Investigation into the twin-arginine translocation pathway of halophilic and thermophilic archaea

  2009cites this paper
• Tat transport of linker-containing proteins in Escherichia coli.

  2009cites this paper
• Twin-arginine-dependent translocation of SufI in the absence of cytosolic helper proteins.

  2009cites this paper
• Bacterial Sec protein transport is rate-limited by precursor length: a single turnover study.

  2009cites this paper
• Interconvertibility of lipid‐ and translocon‐bound forms of the bacterial Tat precursor pre‐SufI

  2009influential citation
• Protein transport across and into cell membranes in bacteria and archaea

  2009cites this paper
• Bioenergetic requirements of a Tat‐dependent substrate in the halophilic archaeon Haloarcula hispanica

  2008cites this paper
• A Stromal Pool of TatA Promotes Tat-dependent Protein Transport across the Thylakoid Membrane*

  2008cites this paper
• Analysis of the dynamic property of Tat translocase and the fate of Tat signal peptides

  2008cites this paper
• The Chloroplast Tat Pathway Transports Substrates in the Dark*

  2008cites this paper
• Following the Path of a Twin-arginine Precursor along the TatABC Translocase of Escherichia coli*

  2008cites this paper
• Characterization and applications of the twin-arginine transporter pathway

  2007influential citation