Characterisation of the membrane‐extrinsic domain of the TatB component of the twin arginine protein translocase

No abstract is available for this paper.

• Publication year

  2011

• Venue

  FEBS Letters

• Publication date

  2011-02-04

• Fields of study

  Biology, Medicine, Chemistry

• Identifiers
  DOI 10.1016/j.febslet.2011.01.016PMID 21237157
• External record

  Open on Semantic Scholar

• Source metadata

  Semantic Scholar, PubMed

• No claims are published for this paper.

• No concepts are published for this paper.

• The Tat Protein Export Pathway

  2010cited by this paper
• Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system

  2009cited by this paper
• Variable stoichiometry of the TatA component of the twin-arginine protein transport system observed by in vivo single-molecule imaging

  2008cited by this paper
• Protein translocation across the bacterial cytoplasmic membrane.

  2008cited by this paper
• The Jpred 3 secondary structure prediction server

  2008cited by this paper
• TatBC, TatB, and TatC form structurally autonomous units within the twin arginine protein transport system of Escherichia coli

  2007cited by this paper
• Molecular Machines Involved in Protein Transport across Cellular Membranes

  2007cited by this paper
• Escherichia coli Twin Arginine (Tat) Mutant Translocases Possessing Relaxed Signal Peptide Recognition Specificities*

  2007cited by this paper
• Molecular machines involved in protein transport across cellular membranes

  2007cited by this paper
• 18 - The Sec and Tat Protein Translocation Pathways in Chloroplasts

  2007cited by this paper
• Cysteine Scanning Mutagenesis and Disulfide Mapping Studies of the TatA Component of the Bacterial Twin Arginine Translocase*

  2007cited by this paper
• Bifunctional TatA subunits in minimal Tat protein translocases.

  2006cited by this paper
• Efficient Twin Arginine Translocation (Tat) Pathway Transport of a Precursor Protein Covalently Anchored to Its Initial cpTatC Binding Site*

  2006cited by this paper
• Cysteine-scanning Mutagenesis and Disulfide Mapping Studies of the Conserved Domain of the Twin-arginine Translocase TatB Component*

  2006cited by this paper
• The TatA component of the twin-arginine protein transport system forms channel complexes of variable diameter.

  2005cited by this paper
• Evidence for interactions between domains of TatA and TatB from mutagenesis of the TatABC subunits of the twin‐arginine translocase

  2005cited by this paper
• Isolation and Characterization of Bifunctional Escherichia coli TatA Mutant Proteins That Allow Efficient Tat-dependent Protein Translocation in the Absence of TatB*

  2005cited by this paper
• Protein transport in Archaea: Sec and twin arginine translocation pathways.

  2005cited by this paper
• Positive Selection for Loss-of-Function tat Mutations Identifies Critical Residues Required for TatA Activity

  2005cited by this paper
• Targeting of Unfolded PhoA to the TAT Translocon of Escherichia coli*

  2005cited by this paper
• The Escherichia coli twin‐arginine translocase: conserved residues of TatA and TatB family components involved in protein transport

  2003cited by this paper
• Differential interactions between a twin-arginine signal peptide and its translocase in Escherichia coli.

  2003influential reference
• Sequence and phylogenetic analyses of the twin-arginine targeting (Tat) protein export system

  2002cited by this paper
• Truncation Analysis of TatA and TatB Defines the Minimal Functional Units Required for Protein Translocation

  2002cited by this paper
• Functional complexity of the twin‐arginine translocase TatC component revealed by site‐directed mutagenesis

  2002cited by this paper
• Oligomeric properties and signal peptide binding by Escherichia coli Tat protein transport complexes.

  2002cited by this paper
• A twin arginine signal peptide and the pH gradient trigger reversible assembly of the thylakoid ΔpH/Tat translocase

  2002cited by this paper
• In vivo dissection of the Tat translocation pathway in Escherichia coli.

  2002cited by this paper
• Characterization and membrane assembly of the TatA component of the Escherichia coli twin-arginine protein transport system.

  2002cited by this paper
• TatB and TatC Form a Functional and Structural Unit of the Twin-arginine Translocase from Escherichia coli *

  2001cited by this paper
• Membrane interactions and self‐association of the TatA and TatB components of the twin‐arginine translocation pathway

  2001cited by this paper
• A bacterial two-hybrid system that exploits a cAMP signaling cascade in Escherichia coli.

  2000cited by this paper
• TatD Is a Cytoplasmic Protein with DNase Activity

  2000cited by this paper
• Sec-independent Protein Translocation in Escherichia coli

  1999cited by this paper
• A bacterial two-hybrid system based on a reconstituted signal transduction pathway.

  1998cited by this paper
• An Essential Component of a Novel Bacterial Protein Export System with Homologues in Plastids and Mitochondria*

  1998cited by this paper
• A novel and ubiquitous system for membrane targeting and secretion of cofactor-containing proteins.

  1998cited by this paper
• A new LexA-based genetic system for monitoring and analyzing protein heterodimerization in Escherichia coli

  1998cited by this paper
• Overlapping functions of components of a bacterial Sec‐independent protein export pathway

  1998cited by this paper
• A common export pathway for proteins binding complex redox cofactors?

  1996cited by this paper
• A Short Course in Bacterial Genetics. A Laboratory Manual and Handbook for Escherichia coli and Related Bacteria. By Jeffrey H. Miller. Cold Spring Harbor Laboratory, Cold Spring Harbor, New York, 1992.

  1993cited by this paper
• The inducible trimethylamine-N-oxide reductase of Escherichia coli K12: biochemical and immunological studies.

  1988cited by this paper
• Tricine-sodium dodecyl sulfate-polyacrylamide gel electrophoresis for the separation of proteins in the range from 1 to 100 kDa.

  1987cited by this paper
• Electrophoretic transfer of proteins from polyacrylamide gels to nitrocellulose sheets: procedure and some applications.

  1979cited by this paper
• Lactose genes fused to exogenous promoters in one step using a Mu-lac bacteriophage: in vivo probe for transcriptional control sequences.

  1979cited by this paper
• Cleavage of Structural Proteins during the Assembly of the Head of Bacteriophage T4

  1970cited by this paper

• Characterization of a TatA/TatB binding site on the TatC component of the Escherichia coli twin arginine translocase

  2022cites this paper
• Twin-arginine translocase component TatB performs folding quality control via a chaperone-like activity

  2022cites this paper
• Twin-arginine translocase component TatB performs folding quality control via a general chaperone activity

  2020influential citation
• Thylakoid‐integrated recombinant Hcf106 participates in the chloroplast twin arginine transport system†

  2018cites this paper
• Thylakoid-integrated recombinant Hcf106 participates in the chloroplast Twin Arginine Transport (cpTat) system

  2018influential citation
• A signal sequence suppressor mutant that stabilizes an assembled state of the twin arginine translocase

  2017cites this paper
• Tat proteins as novel thylakoid membrane anchors organize a biosynthetic pathway in chloroplasts and increase product yield 5-fold.

  2017cites this paper
• FUNCTIONAL INTERACTION ANALYSIS OF CHLOROPLAST TWIN ARGININE TRANSLOCATION (CPTAT) PATHWAY AND ITS ROLE IN PLASTID DEVELOPMENT

  2016cites this paper
• Twin-arginine translocation in Yersinia : the substrates and their role in virulence

  2016cites this paper
• The TatC component of the twin‐arginine protein translocase functions as an obligate oligomer

  2015cites this paper
• Secretome of obligate intracellular Rickettsia.

  2014cites this paper
• Diversity and Evolution of Bacterial Twin Arginine Translocase Protein, TatC, Reveals a Protein Secretion System That Is Evolving to Fit Its Environmental Niche

  2013cites this paper
• Protein translocation across the inner membrane of Gram-negative bacteria: the Sec and Tat dependent protein transport pathways.

  2013cites this paper
• Twin-arginine-dependent translocation of folded proteins

  2012cites this paper
• Twin-arginine translocase mutations that suppress folding quality control and permit export of misfolded substrate proteins

  2012cites this paper
• Escherichia coli TatA and TatB Proteins Have N-out, C-in Topology in Intact Cells*

  2012cites this paper
• Molecular dissection of TatC defines critical regions essential for protein transport and a TatB–TatC contact site

  2012cites this paper
• MSLSRRQFIQASGIALCAGAVPLKASA AGQ MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATA AQA SufI TorA consensus motif cleavage site MQRRDFLKYSVALGVASALPLWSRAVFA AER CueO SRRxFLK

  2012cites this paper
• The twin-arginine translocation (Tat) protein export pathway

  2012cites this paper
• Characterisation of the putative Type VII protein secretion system of Streptomyces spp.

  2011cites this paper
• The twin arginine translocation pathway in Escherichia coli : mechanism and quality control

  2011influential citation
• The Tat-dependent protein translocation pathway

  2011cites this paper
• Early Contacts between Substrate Proteins and TatA Translocase Component in Twin-arginine Translocation*

  2011cites this paper