Synthesis of linkages between benthic and fish communities as a key to protecting essential fish habitat

No abstract is available for this paper.

• Publication year

  2000

• Venue

  Bulletin of Marine Science

• Publication date

  2000-04-30

• Fields of study

  Not labeled

• Identifiers

  No identifiers available.

• External record

  Open on Semantic Scholar

• Source metadata

  Semantic Scholar

• No claims are published for this paper.

• No concepts are published for this paper.

• Cascading of habitat degradation: Oyster reefs invaded by refugee fishes escaping stress

  2001cited by this paper
• Short-Term Consequences of Nourishment and Bulldozing on the Dominant Large Invertebrates of a

  2000cited by this paper
• The use of infauna by juvenile Penaeus aztecus Ives and Penaeus setiferus (Linnaeus)

  1998cited by this paper
• Coastal marine eutrophication: A definition, social causes, and future concerns

  1995cited by this paper
• Organisms as ecosystem engineers

  1994cited by this paper
• Changes in the Diet of Demersal Fish due to Eutrophication-Induced Hypoxia in the Kattegat, Sweden

  1994influential reference
• Environmental impact studies on marine communities: Pragmatical considerations

  1993cited by this paper
• Beach restoration in the southeastern US: environmental effects and biological monitoring

  1993cited by this paper
• Enhancement of marine primary production by nitrogen-enriched acid rain

  1985cited by this paper

• Distribution of benthic communities in a hypertidal estuary: Mapping potential prey resources for juvenile common sole Solea solea

  2026cites this paper
• Can microplastic pollution be affected by beach nourishment? Assessment in intertidal sediment and bivalves.

  2025cites this paper
• Drowning in sand: examining the effects of beach nourishment on subtidal benthic macrofauna in southeast Florida

  2025cites this paper
• Introduction: Honoring the contribution of Charles H. Peterson (1946–2020) to the field of marine ecology

  2023cites this paper
• Potential impacts of the restoration of coastal and estuarine nurseries on the stock dynamics of fisheries species

  2023cites this paper
• Habitat associations of juvenile Atlantic cod (Gadus morhua L.) and sympatric demersal fish communities within shallow inshore nursery grounds

  2022cites this paper
• Living Status and Perspective of the Silver Carp (Hypophthalmichthys molitrix) in the Lower Reach of the Yangtze River: Insights from Population Distribution, Age Structure, and Habitat Preference Analyses

  2022cites this paper
• Effect of Urban River Morphology on the Structure of Macroinvertebrate Communities in a Subtropical Urban River

  2022cites this paper
• A Comparison of the Juvenile Dungeness Crab Metacarcinus magister Habitat Provided by Contemporary Oyster Aquaculture Versus Historical Native Oysters in a U.S. West Coast Estuary

  2021cites this paper
• Distribution pattern of macrobenthic composition, diversity and secondary production in Hangzhou Bay, northern East China Sea

  2021cites this paper
• Effects of reduced shoreline erosion on Chesapeake Bay water clarity.

  2021cites this paper
• Behavioral Response of Fishers to Hypoxia and the Distributional Impact on Harvest

  2021cites this paper
• A Mega-Nourishment (Sand Motor) Affects Landscape Diversity of Subtidal Benthic Fauna

  2021cites this paper
• A Resident Fish Guild as a Higher Trophic Level Indicator of Oyster Reef Restoration Success

  2021cites this paper
• Low Oxygen Zones Predict Future Condition of Fish Under Climate Change

  2021cites this paper
• Otolith chemistry of triplefin Forsterygion nigripenne indicates estuarine residency

  2021cites this paper
• An Ecological Characterization of Fish Assemblages in Mosquito Lagoon, Florida

  2020cites this paper
• Impacts of habitat repair on a spatially complex fishery

  2020cites this paper
• Altered feeding habits and strategies of a benthic forage fish () in chronically polluted tidal salt marshes

  2020cites this paper
• Assessing Nearshore Nekton Abundance, Substrate, and Environmental Conditions in the Northern Gulf of Mexico: Are There Differences Among Three Adjacent Coastal Areas and Have There Been Changes over Three Decades (1986–2015)?

  2019cites this paper
• Examination of intertidal and nearshore benthic macroinvertebrates along two non-nourished Florida beaches

  2019cites this paper
• Identification, recovery, and impact of ghost fishing gear in the Mullica River-Great Bay Estuary (New Jersey, USA): Stakeholder-driven restoration for smaller-scale systems.

  2019cites this paper
• Fish assemblages and life history patterns in estuaries along the Otago coastline, New Zealand

  2019cites this paper
• Ecosystem goods and services

  2019cites this paper
• Ecosystem services of restored oyster reefs in a Chesapeake Bay tributary: abundance and foraging of estuarine fishes

  2019cites this paper
• Spatiotemporal variation in the structure of reef fish and macroalgal assemblages in a north-east Atlantic kelp forest ecosystem: implications for the management of temperate rocky reefs

  2018cites this paper
• Indicators of marine ecosystem integrity for Canada's Pacific: An expert-based hierarchical approach.

  2018cites this paper
• Impacts of green tides on estuarine fish assemblages

  2018cites this paper
• Enhanced Production of Finfish and Large Crustaceans by Bivalve Reefs

  2018cites this paper
• Impacts of a multi-trap line on benthic habitat containing emergent epifauna within the Mid-Atlantic Bight

  2018cites this paper
• Response of the Common Mummichog (Fundulus heteroclitus) to Water Quality Changes in Long Island Sound Tributaries

  2018cites this paper
• Interdecadal changes in the community, population and individual levels of the fish fauna of an extensively modified estuary.

  2017cites this paper
• Spatiotemporal Variability of Benthic Communities on Weathervane Scallop Beds off Alaska

  2017cites this paper
• Exploring the decline of oyster beds in Atlantic Canada shorelines: potential effects of crab predation on American oysters (Crassostrea virginica)

  2017cites this paper
• Exploring the expansion, impact and a control option for European green crab populations in Prince Edward Island, Atlantic Canada

  2017cites this paper
• Assessing anthropogenic impacts on reef communities: patterns, indicators and processes

  2017cites this paper
• Fish ecology in a low oxygen environment: a case study from the Arabian Sea

  2017cites this paper
• Trophic ecology of an Atlantic kelp forest fish assemblage (NW Spain) targeted by recreational fishers and implications for coastal management

  2017cites this paper
• Time series effects of dissolved oxygen and nitrogen on Long Island Sound lobster harvest

  2016cites this paper
• Fish community responses to green tides in shallow estuarine and coastal areas

  2016cites this paper
• Geoinformatics for Fisheries Management

  2016cites this paper
• Effects of beach replenishment on intertidal invertebrates: A 15-month, eight beach study.

  2016cites this paper
• Physiological perturbations in gills and liver of Siganus canaliculatus as potential biomarkers of hydrocarbons pollution in Arabian Gulf of Saudi Arabia.

  2016cites this paper
• Influence of food availability on the spatial distribution of juvenile fish within soft sediment nursery habitats

  2016cites this paper
• The food limitation hypothesis for juvenile marine fish

  2015cites this paper
• Evaluating demersal fish richness as a surrogate for epibenthic richness in management and conservation

  2015cites this paper
• Long-term effects of beach nourishment on intertidal invertebrates

  2015cites this paper
• Spatial and temporal variation in nearshore macrofaunal community structure in a seasonally hypoxic estuary

  2015cites this paper
• Linking the bottom to the top in aquatic ecosystems : mechanisms and stressors of benthic-pelagic coupling

  2015cites this paper
• North Carolina

  2015cites this paper
• Chapitre 1. Intérêts des AMP dans les secteurs côtiers et estuariens

  2015cites this paper
• An investigation of the fisheries ecosystem dynamics in Rhode Island's nearshore waters

  2015cites this paper
• Available Benthic Energy Coefficient (ABEC): a generic tool to estimate the food profitability in coastal fish nurseries

  2015cites this paper
• Environmental siting suitability analysis for commercial scale ocean renewable energy: A southeast Florida case study

  2014cites this paper
• 7KHLQYDVLYH3DFL¿FR\VWHU Crassostrea gigas LQ6FDQGLQDYLDQFRDVWDOZDWHUV $ULVNDVVHVVPHQWRQWKHLPSDFWLQGLIIHUHQWKDELWDWV DQGFOLPDWHFRQGLWLRQV

  2014cites this paper
• Where the waters meet: sharing ideas and experiences between inland and marine realms to promote sustainable fisheries management 1

  2014cites this paper
• Reaction of an estuarine food web to disturbance: Lindeman's perspective

  2014cites this paper
• Coral communities on artificial reefs in the Gulf of Mexico: standing vs. toppled oil platforms

  2014cites this paper
• Review Patterns and processes of habitat-specific demographic variability in exploited marine species

  2014cites this paper
• Effects of hypoxia-induced habitat compression on growth of juvenile fish in the Neuse River Estuary, North Carolina, USA

  2014cites this paper
• Cold water coral reef management from an ecosystem service perspective

  2014cites this paper
• The invasive Pacific oyster, Crassostrea gigas, in Scandinavian coastal waters: A risk assessment on the impact in different habitats and climate conditions

  2014cites this paper
• A quantitative estimate of the function of soft-bottom sheltered coastal areas as essential flatfish nursery habitat

  2013cites this paper
• Factors affecting the habitat usage of estuarine juvenile fish in northern New Zealand

  2013cites this paper
• Patterns of sandy-beach macrofauna production

  2013cites this paper
• Deepwater Coral Distribution and Abundance on Active Offshore Oil and Gas Platforms and Decommissioned Rigs-to-Reefs Platforms

  2013cites this paper
• DEGRADATION OF SURF-FISH FORAGING HABITAT DRIVEN BY PERSISTENT SEDIMENTOLOGICAL MODIFICATIONS CAUSED BY BEACH NOURISHMENT

  2013cites this paper
• Effec ts Of Hypoxia On The S patial Distribution Of Marine Megafauna In The N orthwestern Gulf Of

  2013cites this paper
• Videographic analysis of the Coelacanth, Latimeria Chalumnae, and associated habitats in the Isimangaliso Wetland Park, KwaZulu-Natal, South Africa

  2012cites this paper
• Trophic ecology of juvenile flatfish in a coastal nursery ground: contributions of intertidal primary production and freshwater particulate organic matter

  2012cites this paper
• Spatially variable effects of a marine pest on ecosystem function

  2012cites this paper
• Brazilian sandy beach macrofauna production: a review

  2012cites this paper
• Fish−habitat associations in New Zealand: geographical contrasts

  2012cites this paper
• Oyster reef restoration in the northern Gulf of Mexico: effect of substrate and age on ecosystem services

  2012cites this paper
• Vulnerability of Portuguese estuarine habitats to human impacts and relationship with structural and functional properties of the fish community

  2012cites this paper
• Secondary production of sandy beach macrofauna: An evaluation of predictive models

  2012cites this paper
• Estuarine, Coastal and Shelf Science

  2012cites this paper
• DOCTEUR D'AGROCAMPUS OUEST

  2011cites this paper
• Proposed Hydrogeomorphic Classification for Wetlands of the Mid-Atlantic Region, USA

  2011cites this paper
• Valuing Ecosystem Services with Fishery Rents: a Lumped-parameter Approach to Hypoxia in the Neuse River Estuary

  2011cites this paper
• Altered feeding habits and strategies of a benthic forage fish (Fundulus heteroclitus) in chronically polluted tidal salt marshes.

  2011cites this paper
• Reduction of flatfish habitat as a consequence of the proliferation of an invasive mollusc

  2011cites this paper
• Benthic Macrofauna Associated with Submerged Bottoms of a Tectonic Estuary in Tropical Eastern Pacific

  2011cites this paper
• Growth and Physiology of Eastern and Suminoe Oysters and the Implications of Increased Habitat Complexity for Associated Oyster Reef Fauna

  2011cites this paper
• The Willapa Bay Oyster Reserves in Washington State: Fishery Collapse, Creating a Sustainable Replacement, and the Potential for Habitat Conservation and Restoration

  2011cites this paper
• Assessment of benthic trophic status of marine coastal ecosystems: Significance of meiofaunal rare taxa

  2011cites this paper
• Sediment identification using free fall penetrometer acceleration-time histories

  2011cites this paper
• Marine Geomorphology in the Design of Marine Reserve Networks

  2011cites this paper
• The effects of environmental stressors on coastal fish : in situ and experimental approach

  2011influential citation
• Les effets des facteurs de stress environnementaux sur les poissons côtiers : approche expérimentale et in situ

  2011influential citation
• Modeling water quality and hypoxia dynamics in Upper Charlotte Harbor, Florida, U.S.A. during 2000.

  2010cites this paper
• Interdisciplinarity in ecosystem management

  2010cites this paper
• Effect of nursery habitat degradation on flatfish population: Application to Solea solea in the Eastern Channel (Western Europe)

  2010cites this paper
• The ecological and economic value of cold-water coral ecosystems

  2010cites this paper
• Effect of nursery habitat degradation on flatfish population : Application to Solea solea in the Eastern Channel ( Western Europe )

  2010cites this paper
• Dynamics of an estuarine nursery ground: the spatio-temporal relationship between the river flow and the food web of the juvenile common sole (Solea solea, L.) as revealed by stable isotopes analysis

  2010cites this paper
• Estimating Linkages between Redfish and Cold Water Coral on the Norwegian Coast

  2010cites this paper
• Effects of habitat structural complexity on nekton assemblages: lab and field observations in southern Louisiana

  2010influential citation
• Using a remote drift underwater video (DUV) to examine dredge impacts on demersal fishes and benthic habitat complexity in Foveaux Strait, Southern. New. Zealand.

  2009cites this paper
• Comparison of Perkinsus marinus infection and oyster condition in southeastern North Carolina tidal creeks

  2009cites this paper